New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

Sign up for GitHub

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

Jump to bottom

number of hits should be more prominent #117

Open

yannickwurm opened this issue May 29, 2016 · 1 comment

Member

yannickwurm commented May 29, 2016

We should make it clearer to users that they shoudl consider # of hits and stars together: more hits = more confidence in stars....

reason this came up:

not sure we should be reporting on something like the following (only 7 swissprot hits).

augustus_masked-scaffold63-processed-gene-0.1-mRNA-1 protein AED:1.00 eAED:1.00 QI:0|0|0|0|1|1|4|0|197
MFQTGAVKIIANTVPWHQSYSATADHLIAVTWLPVVMCGAVPAMVRSVSLYSTCSSGNVTVIGRNVKAVGRDDHNAPYRNCFVKVGFVKVIYNEVPVSSCVTEKLTTQSEDFSRRLYIFAEKSQRYICFNKRWKLVALPKKQKGPMCQFYEVYNGSYLRYRSAVDGTRYIGFNKIGNPMK
NPNGRQECFNFIKYNPH

Member

IsmailM commented Sep 30, 2018

We now have --min_blast_hits_required to allow users to choose min (default is still 5).

What do you think is a fix for this - Shall we move the hits column next to the GV Score Value so that they are seen together?

Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment